Second Brain

A second brain is a place to capture and organize ideas and information. Instead of using a structure of folders, everything connects together with links.

There are second brain links all over my website. They will guide you from idea to idea. You never know what you might find!

If you want to create your own second brain, you might want to look at Foam, Roam, or Obsidian.

1600s16751800s18141846185719472000s20042020-09-012020-09-042020-09-082020-09-092020-09-102020-09-112020-09-122020-09-132020-09-142020-09-152020-09-182020-09-192020-09-212020-09-222020-09-232020-09-242020-09-252020-09-262020-09-282020-09-292020-10-022020-10-032020-10-052020-10-062020-10-072020-10-082020-10-092020-10-152020-10-162020-10-172020-10-192020-10-202020-10-212020-10-222020-10-232020-10-252020-10-262020-10-272020-10-282020-10-292020-10-302020-11-012020-11-022020-11-032020-11-062020-11-072020-11-082020-11-092020-11-102020-11-112020-11-172020-11-212020-11-232020-11-242020-11-252020-11-262020-11-302020-12-042020-12-0920202021-01-082021-01-112021-01-122021-01-132021-01-172021-01-192021-01-202021-01-242021-02-052021-02-082021-02-092021802-11a-posterioria-prioriaaron-swartzabductive-argumentabstractionaccelerationaccretion-diskachillesacmada-lovelaceagent-causationalan-turingalbert-einsteinalgorithmalice-zhaoan-enquiry-concerning-human-understandinganachronismanalogical-argumentanalogical-reasoninganalytical-engineangular-momentumangular-resolutionannie-jump-cannonanselmant-plusantarctic-circleanti-realismantimatterapiapplication-layerarctic-circlearduinoargumentaricebo-telescopearistotlearithmetic-logic-unitarparpanetarrayartificial-intelligenceartificial-neural-networkasciiassemblerassembly-languageasteroid-beltasteroidastr-1101astr-1102astrobiologyastronomerastronomical-unitastronomyatheistatlas-vatmosphereatomatomic-habitsautumnal-equinoxawarenessbaryon-cyclebasaltbasicbatterybdnfbe-water-my-friendbegging-the-questionbell-labsbetelgeusebig-bangbig-databig-obinary-searchbinary-starbinaryblackbodyblaise-pascalbletchley-parkbluetoothbob-bemerbookboolean-algebrabrown-dwarfbruce-leebubble-sortbytecodeccallistocameracarbon-monoxidecarbon-nitrogen-oxygen-cyclecardinality-constraintcartesian-skepticismcascadiajscassini-huygenscausationccdcecilia-payne-gaposchkincelestial-equatorcelestial-polecelestial-spherecepheid-starcereschandrasekhar-limitcharacter-setcharles-babbagecharles-darwincharonchinese-roomchristianitychromatic-aberrationchromospherecidrcircuitclassical-mechanicscloud-computingcobolcoherentismcolourcometcompany-interview-questionscompanycomparative-planetologycompatibilismcompiled-programming-languagecompilercompressioncomputer-graphicscomputer-memorycomputer-sciencecomputer-scientistcomputercomputing-systemsconductionconservation-lawconstellationcontrol-unitconvectioncopernicuscoriolis-effectcoronacoronal-mass-ejectioncosmological-argumentcppcpsc-1045cpsc-1050cpsc-1480cpucryptanalystcryptographycurrentcyanoacetylenedark-energydark-matterdata-link-layerdata-structuredatabase-management-systemdatabasedavid-humedecimaldeductive-argumentdensityderek-parfitdesign-argumentdesigndeterminismdhcpdialogues-concerning-natural-religiondifferentiationdigital-gardendirect-realismdisk-schedulingdispersiondiurnal-motiondiversitydns-recordsdnsdoppler-effectdoppler-shiftdoppler-spectroscopydualismdwarf-planete-ubceartheclipseeclipticedmund-gettieregoejnar-hertzsprungelectricityelectromagnetic-radiationelectromagnetic-spectrumelectromagnetismelectron-shellelectronelementelizabeth-anscombeellipseelon-muskempiricismempiricistenceladusencryptionenergyepictetusepistemic-stateepistemologyequatorequinoxerisesaescape-velocityessential-startup-adviceethernetethicseuropaevidentialismevilexoplanetexosphereexternalismeyefalcon-9fallacyfalsification-principlefibonacci-sequencefile-systemfirewallfissionfocal-lengthfocal-pointfocal-ratioforcefortranfoucault-pendulumfoundationalismfree-fallfree-willfreedomfrequencyfrictionfunctional-programmingfunctionalismfungifusiongalaxiesgalileogamma-ray-telescopegamma-rayganymedegeocentric-modelgeological-processesgeologygeometric-sequencegeometric-seriesgeorge-boolegettier-problemgiant-molecular-cloudgiant-stargifglobular-clustergogodgottfried-wilhelm-leibnizgrace-hoppergrady-boochgraphgravitygreecegreek-mythologygreekgreenhouse-effectgrokking-algorithmsgustav-kirchhoffh-r-diagramhackathonhardwareheavy-bombardmentheliocentric-modelhelioseismologyhelium-fusionheliumhenry-norris-russellhete-2hikehistory-of-computinghuameahumanhuygens-probehydrogenhydrostatic-equilibriumhypervisoricmpideaideal-gas-lawidealismidries-shahiliadinboxindeterminismindirect-realisminductive-argumentinertiainfinite-regressinformation-securityinfrared-telescopeinput-outputinsertion-sortinstability-stripinstrumentalismintegerinternalisminternetinterpreted-programming-languageinterpreterinterstellar-extinctioninterstellar-mediuminterstellar-reddeninginverse-square-lawinverted-spectrumioionosphereip-addressipipv4ipv6ironisaac-newtonjacquard-loomjames-clark-maxwelljames-clearjames-steinbachjava-virtual-machinejavajavascriptjeans-instabilityjoel-hooksjohannes-keplerjohn-f-kennedyjohn-lockejohn-searlejohn-von-neumannjoseph-jacquardjovian-planetjpegjupiterjustified-true-beliefkardashev-scalekarl-popperkepler-space-telescopekirchoff-s-laws-of-spectroscopyknowledgekonrad-zusekuiper-beltkurzgesagtlanlangaralaniakea-superclusterlatitudelaw-of-conservation-of-energylaws-of-motionleadershiplearn-in-publicleonardo-bonaccilibertarianismlight-curvelight-yearlightlinked-listlisplithium-ion-batterylogic-diagramlogic-gatelogiclogicianlongitudeloopluminositymac-addressmachine-codemachine-languagemagnetic-fieldmagnetismmain-sequence-starmain-sequencemakemakemalicious-codemarcus-aureliusmarsmass-luminosity-relationmassmaterialismmathmathematicianmattermatthew-mcconaugheymeditationmeditations-on-first-philosophymemorymensamental-healthmercurymeridianmesospheremetaphysicsmeteor-showermeteormeteoritemethanemethodmilky-way-galaxymiller-s-lawmime-typesmind-body-problemmind-brain-identitymindmirrormlhmomentummoonmotherboardmotionmythologynasanassim-nicholas-talebnatural-numbersnaval-ravikantnebulanecessityneptunenetwork-documentationnetwork-hardwarenetwork-idnetwork-infrastructurenetwork-layernetwork-modelsnetwork-segmentationnetwork-switchnetwork-troubleshootingnetworknetworkingneural-networkneutrinoneutron-starnew-horizonsnon-profit-organizationnuclear-reactionnumber-theorynumerica-identitynumerical-identityobject-oriented-programmingobjectivityoccam-s-razorole-rømerontological-argumentoort-cloudopen-clusteroperating-systemoppenheimer-volkov-limitorbitosi-modelownershipozonepablo-picassopanspermiaparallaxparallel-computingparity-bitsparsecparticlepascal-s-wagerpascalpatrocluspeleuspeoplepep9period-luminosity-relationpersonal-identitypeurto-ricophil-1101phil-2203philosopherphilosophical-behaviorismphilosophical-health-checkphilosophical-skepticismphilosophyphotographyphotometryphotonphotospherephthiaphysical-layerphysicspioneer-10pioneer-11plageplanetplanetary-motionplanetary-nebulaplate-tectonicsplatoplutopolarispolynomialpositronpowerpragmatic-argumentpragmatismprecessionpresentation-layerprime-meridianprinciple-of-equivalenceprinciple-of-sufficient-reasonprinciple-of-uniformity-of-natureproblem-of-free-willproblem-of-inductionproduct-huntprogramprogramming-languageprogramming-paradigmprogrammingprojectprominenceprotagoras-dialogueprotagorasproton-proton-chainprotonproxima-centauripsychologismptolemypythagoraspythonqualiaqualitative-identityquantum-mechanicsquantumscapequeuequicksortquoteradial-velocityradiationradio-telescoperadio-wavesrainbowralph-waldo-emersonrascrational-numbersrationalismrationalistreadreal-numbersrealismrealistrealityrecursionrecursive-formulared-dwarfreductio-ad-absurdumredwoodjsreflecting-telescoperefracting-telescoperegularity-theoryrelational-databasereliabilismrene-descartesretrograde-motionreworkrfidring-systemroboticsrocketrosetta-missionrouterrr-lyrae-starrustsalary-negotiationsaturn-vsaturnsciencescientific-methodsecurityselection-sortself-improvementsemiconductorsenecasequencesequential-searchseriessession-layershannon-leesherlock-holmessheryl-sandbergsigcse-awardsiliconsimulationsocratessoftware-defined-networkingsoftware-engineeringsoftwaresolar-flaresolar-systemsolar-windsolid-state-lithium-metal-batterysolipsismsouthern-hemispherespace-missionspacespacexspectraspectral-analysisspectroscopyspeedspiculesqlsslst-thomas-aquinasstackstar-classificationstar-clusterstarstartupstefan-boltzmann-lawstellar-evolutionstellariumstoicismstratospherestraw-mansubnet-masksubnettingsufficiencysulfur-dioxidesummer-solsticesunsunspotsupergiant-starsupernovasystems-programmingtalatcp-iptcptelescopetemperatureterminal-heroterrestrial-planettesstestingthe-great-attractorthe-moonthe-solar-systemtheisttheodolitethermal-emission-spectrumthetistidal-forcetidal-heatingtime-to-livetimetitantitanic-effecttlsto-laugh-oftentodotransistortransistorstransit-methodtransit-regiontransport-layertreatise-of-human-naturetreetritontropospheretruth-tableturing-machineturing-testtycho-braheudpultraviolet-raysultraviolet-telescopeunicodeuniformitarianismunited-statesuniversal-law-of-gravitationuniverseuranusvalue-theoryvariable-starvariablevectorvelocityvenusvernal-equinoxviktor-franklvincent-van-goghvirtual-machinevlanvoipvolcanovoltagevolumevon-neumann-architecturevoyager-1voyager-2voyager-missionvulcanwatchwaterwattwave-particle-dualitywavewavelengthwe-watch-techwhite-dwarfwiens-lawwilliam-herschelwilliam-jameswilliam-paleywilliamina-flemingwinter-solsticewireless-networkingworld-war-iiwritex-ray-telescopex-raysyearyellow-dwarfz-wavezeeman-effectzen-beginner-s-mindzigbee